SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|75812448|ref|YP_320067.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75812448|ref|YP_320067.1|
Domain Number 1 Region: 2-329
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 2.78e-97
Family Deoxyhypusine synthase, DHS 0.0000213
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|75812448|ref|YP_320067.1|
Sequence length 347
Comment deoxyhypusine synthase-like protein [Anabaena variabilis ATCC 29413]
Sequence
MNREELLQETVQPIDIKAFDVVGLVEAMSKTAFQGRNLGRAAKIYDAMLQDKECTIILCL
AGSLFSAGLKGIVHDLITHNMVDAIVSTGANIVDQDFFEALGYRHYVGDPFADDEVLRQQ
RIDRIYDTYIDEDQLRVCDMTIAEIAENLEKRPYSSREFIEQMAVYLERRGNYGQSVVQA
AYQHQVPIFVPAFSDCSAGFGLVHHQWNSPESHVTIDSVRDFRELTQCKLASNYTGLVMI
GGGVPKNFAQDTVVAAELLGFETSMHKYTIQVTVADERDGALSGSTLKEAHSWGKVDKAT
EQMVFSEATVALPLIAGYAYHKGNWRDRQPHRLAQLFTKPQPKVATV
Download sequence
Identical sequences A0A1W5CM30 Q3M2A8
gi|75812448|ref|YP_320067.1|NC_007410 gi|75812448|ref|YP_320067.1| 240292.Ava_B0166

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]