SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|75812474|ref|YP_320093.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75812474|ref|YP_320093.1|
Domain Number 1 Region: 43-145
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 4.32e-27
Family Pentapeptide repeats 0.00064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|75812474|ref|YP_320093.1|
Sequence length 181
Comment pentapeptide repeat-containing protein [Anabaena variabilis ATCC 29413]
Sequence
MMIYFIRPLIPLTLLLTPSLISQVNDFFRQNAIKQLQETRRCFSCNLSGINLSGGNLQAV
DLRSTNLQGANLKNANLRYANLQWADLRNVNLQGADLTGANLSFSLLVNANLQGANLEGS
NLKMAGLRNSNFSYANLIKASLSQNLQNSHSVNLCRTMLPGGTMMSGDCNNMPPQKTGLL
K
Download sequence
Identical sequences Q3M282
gi|75812474|ref|YP_320093.1| gi|75812474|ref|YP_320093.1|NC_007410 240292.Ava_B0192

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]