SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|75812572|ref|YP_320191.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75812572|ref|YP_320191.1|
Domain Number 1 Region: 6-154,263-389
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 3.75e-33
Family Glutathionylspermidine synthase ATP-binding domain-like 0.038
Further Details:      
 
Domain Number 2 Region: 163-270
Classification Level Classification E-value
Superfamily PreATP-grasp domain 0.0000000000719
Family Glutathionylspermidine synthase substrate-binding domain-like 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|75812572|ref|YP_320191.1|
Sequence length 392
Comment glutathionylspermidine synthase-like [Anabaena variabilis ATCC 29413]
Sequence
MNLTRKQFYEQYKDIFSWYDADGYACYDVLTVSPQIIEKVKQAAANVWPILLQAANIMRS
LDTDTLLNFDYPAETLRLIKSSIQPPFIARCDFAINNDKVYLLECNAEVATFIAETFKIN
GIVANHFGKTDPNLKSELILQQQLNKYIELAAEYLNKSPQDCHIIFSALSQADEDIGTVE
YLRSLCQYKSAYCPIEKITMDEQYVYDHIDRKVDIIYRLYPTEWMVEDKDPNLGVSLWDY
LEPLVYDKKVALINPLSSFIIQNKALMALITELGLDNSLKNSQSGYSHFLPTFMKDSHIS
YPFVSKPTWGREGKEVEIFKSEISLINNPSPDYSHLYKVYQQYVDMPLIKMEEDTYTLQL
SCFLINGIPEGVGARIGKDLITNTSKFLPIGY
Download sequence
Identical sequences A0A1W5CKU8 Q3M1Y4
gi|75812572|ref|YP_320191.1| 240292.Ava_B0291 gi|75812572|ref|YP_320191.1|NC_007410 APC37901

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]