SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|75812632|ref|YP_320250.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75812632|ref|YP_320250.1|
Domain Number 1 Region: 81-185
Classification Level Classification E-value
Superfamily SMAD/FHA domain 4.02e-16
Family FHA domain 0.0048
Further Details:      
 
Weak hits

Sequence:  gi|75812632|ref|YP_320250.1|
Domain Number - Region: 3-25
Classification Level Classification E-value
Superfamily Rubredoxin-like 0.0589
Family Rubredoxin 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|75812632|ref|YP_320250.1|
Sequence length 187
Comment FHA domain-containing protein [Anabaena variabilis ATCC 29413]
Sequence
MITCTACGYDKNPDDAEYCDACGSELQTVAAPTSTSSVAPTVLQSPIIEQEIPAPQIPQP
TYPTSTPTSPTFSTTATTAKLISKQPGSPIAEFSLDSNAVVGIFDPDMGPVDIDLEEFPG
GNTVSRNHAEIYIEGGVWKIKDLGSTNGVFIKQSSQTRFGARITVPETINFGDEIAFGKV
RFLFQST
Download sequence
Identical sequences A0A1W5CPW0 Q3M1S5
gi|75812632|ref|YP_320250.1| gi|75812632|ref|YP_320250.1|NC_007411 240292.Ava_A0003 2005145857

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]