SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|75812683|ref|YP_320300.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|75812683|ref|YP_320300.1|
Domain Number - Region: 314-340
Classification Level Classification E-value
Superfamily Rubredoxin-like 0.0895
Family Rubredoxin 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|75812683|ref|YP_320300.1|
Sequence length 374
Comment IS891/IS1136/IS1341 transposase [Anabaena variabilis ATCC 29413]
Sequence
MKTLKFKLYQHKRNRHLKRIINAAGVIYNHCIALHKRYYRMWGNHLSCAKLQSHIAKLRK
RNLFWQSLGSQAVQDICQRIEKAYQLFFKHNKKGVRPPGFKKVKKYKSFTLKQAGYKFLG
SNRVKIGHRVYQFWKSRDIEGTVKTLTIKRTPLGELFMVVVVDNVSQAEIEVKTGKIAGF
DFGLKTFLTCSDGTKIESPQFFKQSLNAIKKASRQHSKKLKSSSNRERARKNLVRKYEDI
SHRRRDWFWKLAHELTDKFDILCFETLNLKGMQRLWGRKISDLAFGEFLQILKWIAKKKN
KLVVFIDQWYPSTKTCSGCGHVLEELDLSIREWRCPSCQSVNGRDENASKVICAVGASTV
GLGDVSRYETAIAV
Download sequence
Identical sequences A0A1W5CDZ6 Q3M1N9
gi|75812683|ref|YP_320300.1|NC_007412 382577 gi|75812683|ref|YP_320300.1| 240292.Ava_C0022

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]