SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|75812732|ref|YP_320349.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|75812732|ref|YP_320349.1|
Domain Number - Region: 320-348
Classification Level Classification E-value
Superfamily Rubredoxin-like 0.0447
Family Rubredoxin 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|75812732|ref|YP_320349.1|
Sequence length 395
Comment IS891/IS1136/IS1341 transposase [Anabaena variabilis ATCC 29413]
Sequence
MEKAYRYRFYPTIEQESLLRRTIGCVRLVFNRALAARTEAWYERQERVDYVQTSAMLTQW
KKLDDLQFLNEVSCVPLQQGLRHLQTAFSNFFAGRARYPNFKKKRSGGSAEFTKSAFKWK
DGQVYLAKCSQPLPIKWSRQLPKDCKPTTITVKLDPSGRWFVSLQIDDSTDETMQPVDSA
VGLDVGVSSLVTLSTGEKIANPKAFDKHYQKLRRAQKALSRKQKASRNRDKARLKVARIQ
AKISDSRKDHLHKLTTRLIRENQTIVVEDLAVKNMVKNPKLARAINDAAWGELVRQLEYK
AKWYGRALVKIDRWFPSSKRCGHCGHVVEKLPLSVREWDCPNCGTHHDRDINASRNILAV
GHTVTVCGANVRPDRHMSKGQLQKSSNGRKQKPKS
Download sequence
Identical sequences A0A1W5CJ71 Q3M1I3
gi|75812732|ref|YP_320349.1|NC_007412 gi|75812732|ref|YP_320349.1| 240292.Ava_C0071 APC66217.0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]