SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|75812783|ref|YP_320400.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75812783|ref|YP_320400.1|
Domain Number 1 Region: 30-149
Classification Level Classification E-value
Superfamily ParB/Sulfiredoxin 1.01e-27
Family ParB-like nuclease domain 0.00094
Further Details:      
 
Domain Number 2 Region: 113-142,176-250
Classification Level Classification E-value
Superfamily KorB DNA-binding domain-like 3.01e-16
Family KorB DNA-binding domain-like 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|75812783|ref|YP_320400.1|
Sequence length 328
Comment ParB family protein [Anabaena variabilis ATCC 29413]
Sequence
MSQKRELEKLTGLDNLFGDDEEKSLSDSTLPLSQIILPPSQPRRYFDPVKLKSLADSIKE
VGLLEPIVVRKIQEDKYEMVAGERRLKACEIAKLEAIPVVIIECDEKKARKLRLVENLQR
EDLNAYEETIGILELLAEELDIDQETVVKLLYDMNNESKGNSNHNVMVSEEGRIIQDVFS
KLGKITWQSFVANRLPLLKLHLDIQTALQKGEIEYTKAKEINRIKNDDERQKVLNKAIAE
GLSLSEIRILVVNILQQQSENKPSSHNQEQKEKADKIYKALRKSKIWNDEKKLKKINKLF
AQIEALLEEENKDDPSLQQGSLVSENSL
Download sequence
Identical sequences A0A1W5CMM2 Q3M1D2
gi|75812783|ref|YP_320400.1|NC_007412 gi|75812783|ref|YP_320400.1| 240292.Ava_C0123

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]