SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|75812865|ref|YP_320482.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75812865|ref|YP_320482.1|
Domain Number 1 Region: 165-265
Classification Level Classification E-value
Superfamily Homing endonucleases 0.000000000289
Family Group I mobile intron endonuclease 0.09
Further Details:      
 
Domain Number 2 Region: 10-91
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000248
Family Myb/SANT domain 0.035
Further Details:      
 
Domain Number 3 Region: 274-362
Classification Level Classification E-value
Superfamily Homing endonucleases 0.00000383
Family Group I mobile intron endonuclease 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|75812865|ref|YP_320482.1|
Sequence length 381
Comment hypothetical protein Ava_C0208 [Anabaena variabilis ATCC 29413]
Sequence
MTKKFTMKNWNRWNTEEEKLLTRLVTKCSNIDEIHQEYFPYRSRQSVKGKLRLLGLTLEP
QWTVEEEEILHELYSELSPKMIQYQFMPHRTLPAIHAKAQRLNLKQRHRWTKDEIRYLKD
NYLTETYEVIGKKLGRDEAGVRAKAQAMKLRKLESYTVNHNYFSTPNLENCYWAGFLAAD
GCINYSSHGYILEVGLQEQDLEHLRILKDLLECDRQIAEMHNSNQKHQYPFGKTYTNGKA
FRLRINSKQICDDLIGRFNITPNKSLTLKPPELDNEQLIKAFIIGLIDGDGGVNLFKVKG
KVNSIEIDLTGTIEVLNWVKNWFDIWVSNNHYKCAKPKQSMNSKAYRYHVAGKRGIELWK
ILSQVNVPKLKRKWHKPLPYF
Download sequence
Identical sequences A0A1W5CK52 Q3M150
gi|75812865|ref|YP_320482.1|NC_007412 240292.Ava_C0208 gi|75812865|ref|YP_320482.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]