SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|75812878|ref|YP_320495.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|75812878|ref|YP_320495.1|
Domain Number - Region: 93-158
Classification Level Classification E-value
Superfamily ARM repeat 0.00288
Family PBS lyase HEAT-like repeat 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|75812878|ref|YP_320495.1|
Sequence length 178
Comment hypothetical protein Ava_C0221 [Anabaena variabilis ATCC 29413]
Sequence
MNQEEPNYIQSTFNQENTVNPMDLLFDEKWLRKAVEAEDKVGGKIGAGLDWGSGFGDLML
NFELLGRLTTLRVSLNREVRLLLNNWNLGTATKIAVKTARDRLLQRLKQPTPEVREQILI
VLGKDELYGEEFISNREIMRELLAVLLKQEDWETIAAVAADSLKETIMYQVSVEKISA
Download sequence
Identical sequences A0A1W5CK90 Q3M137
240292.Ava_C0221 gi|75812878|ref|YP_320495.1|NC_007412 gi|75812878|ref|YP_320495.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]