SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|75906407|ref|YP_320703.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75906407|ref|YP_320703.1|
Domain Number 1 Region: 1-279
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 1.04e-73
Family Cytidylytransferase 0.0093
Further Details:      
 
Domain Number 2 Region: 247-431
Classification Level Classification E-value
Superfamily Trimeric LpxA-like enzymes 3.3e-30
Family gamma-carbonic anhydrase-like 0.033
Further Details:      
 
Domain Number 3 Region: 636-743
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 2.77e-19
Family Phosphoglucomutase, first 3 domains 0.008
Further Details:      
 
Domain Number 4 Region: 744-831
Classification Level Classification E-value
Superfamily Phosphoglucomutase, C-terminal domain 0.00000000000968
Family Phosphoglucomutase, C-terminal domain 0.0093
Further Details:      
 
Domain Number 5 Region: 371-557
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 0.0000000000294
Family Phosphoglucomutase, first 3 domains 0.005
Further Details:      
 
Domain Number 6 Region: 531-632
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 0.000000000549
Family Phosphoglucomutase, first 3 domains 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|75906407|ref|YP_320703.1|
Sequence length 842
Comment phosphoglucomutase/phosphomannomutase alpha/beta/subunit [Anabaena variabilis ATCC 29413]
Sequence
MRAVLMAGGSGTRLRPLTCDLPKPMVPILNRPIAEHIINLLKRHHITEVIATLHYLPDVL
RDYFQDGGDFGVQMTYAVEEDQPLGTAGCVKNIAELLDETFLVISGDSITDFDLGEAIAF
HKQKQSKATLILTRVPNPIEFGVVITDEAGKIKRFLEKPSTSEIFSDTVNTGTYILEPEV
LEYLPLNTECDFSKDLFPLLLAKDEPMYGYVAEGYWCDVGHLDAYREAQYDALERKVKLD
FAYRENSPGLWIGQNTYIDPSAHIEAPVVIGNNCRIGARVQIEAGTVIGDNVTIGADANL
KRPIVWNGAIIGEEAQLSACVISRGTRVDRRAHVLEASVVGSLSTVGEEAQISPGVRVWP
SKKIESGAILNINLIWGNTAQRNLFGQRGVQGLANIDISPEFAVKLGAAYGSTLKPGAKV
TVSRDQRNVSRMVTRSLIAGLMSVGVDIQNLDATAIPIARTVIPTMGVAGGIHVRVHPDR
ADYILIEFMDHKGINISKAQEKKIEGAYFKEDMRRALTHEIGDVAYPSQVIDLYCTAFEK
LLNVSTLHNSRAKVVIDYVYAVSGAVLPQMLDKFGADAVVLNASLNKNAVTTTDREGLLT
QLGHVVEALKANFGVQVSANGEQLILVDESGYPIRGELLTALMVDMILTSNPRGTVVVPV
HASSAVEQVARRHDGRIIRTKANATALMEACQKNPNVVLGGSGETGFIFPQLHPGFDSMF
CIAKIIEMLTIQERSLATVRSELPRVIYRTHTIRCPWSAKGALMRYLVETHPAQNLELID
GVKIRQPFDDSWLLVLPDASEPLVHLYANSHERDWVDETVRDYRSRVQSFVERQQEYHPA
EV
Download sequence
Identical sequences A0A1W5CJB8 Q3MGS8
240292.Ava_0182 gi|75906407|ref|YP_320703.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]