SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|75906503|ref|YP_320799.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75906503|ref|YP_320799.1|
Domain Number 1 Region: 39-222
Classification Level Classification E-value
Superfamily GAF domain-like 0.0000000000012
Family GAF domain 0.01
Further Details:      
 
Domain Number 2 Region: 242-462
Classification Level Classification E-value
Superfamily PP2C-like 0.000000497
Family PP2C-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|75906503|ref|YP_320799.1|
Sequence length 463
Comment serine phosphatase [Anabaena variabilis ATCC 29413]
Sequence
MPVPQFSSQPTDNNNSAATDVTPVVALKELVSRLHREQNKIQDLLSSLGFALRSFNNLNQ
FLELIPLMATRVTDADGSALFLYKPNGQVRLEQLHWQDSRQRKNIRKALETASSQITLLP
NTAPLANATGMLDDQMHRYLGPDVQIFGTAILVKHTERGWLYVLSRDPEYSWTETRQKLV
RLVADQTAVAIENDELAVELRKKERLDQELEIGAEIQRRLLPRQCPHIPGVSLAARCRPA
NRVGGDYYDFIPTNQSQIHPYTKLGQDSGRWGLVIGDVMGKGVPAGLIMTMMRGMLRGEV
LHGNSPAGILQNLNRVMYADLENSHRFITLFYSEYNPHKRILSYSNAAHNPPLWWHAATK
SVTRLDTLGMLIGLDANSQYEDGHAQLEPGDTVIYYTDGLTDAAAASGDRFDEENFVTAF
STACRYCNGPEEIVDYLFDRVQQFIGADRQNNDDMTLVVLQIE
Download sequence
Identical sequences A0A1W5CG34 Q3MGI2
gi|75906503|ref|YP_320799.1| 240292.Ava_0278

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]