SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|75906579|ref|YP_320875.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75906579|ref|YP_320875.1|
Domain Number 1 Region: 410-667
Classification Level Classification E-value
Superfamily PP2C-like 1.07e-50
Family PP2C-like 0.00013
Further Details:      
 
Domain Number 2 Region: 169-266
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.000064
Family Protein kinases, catalytic subunit 0.022
Further Details:      
 
Weak hits

Sequence:  gi|75906579|ref|YP_320875.1|
Domain Number - Region: 25-49
Classification Level Classification E-value
Superfamily Zn-binding ribosomal proteins 0.00167
Family Ribosomal protein L40e 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|75906579|ref|YP_320875.1|
Sequence length 680
Comment putative protein serine/threonine phosphatase [Anabaena variabilis ATCC 29413]
Sequence
MLICPQCEFENPNANKFCQKCGASLSHKVCPQCSTEVPVNAENCHNCGAETGTVWRAIIE
TGDWAAAVSVSTLLSANPVDVASPKEDQTELGFEEDGEEKIMLSPALFSVGSYLDKEQRY
QILQVLSAAHDEVSVRVLDCQPYQVSPIEAILANQQQGLVTPAVEANGIPSLARAYMVLQ
SQNHTEIPRIHDAWEDGDNQILLIEDRTHYQPLLDLWQKETTSSLEILHWFYQMTQLWVL
LEPLKCHYSLWDLANLCLDEDQTISLRKLYVKPPKSELAIDYLPLDFNPVTAQEEDVTLP
IFVQPSSIKALGEVWQALFRESQRTQFGSIIQILGDLQQGRIYSIAQLRSRLQEVATELE
ATTPPIFEPMEAEQTNAPTVLQADDTEDPSGKGDDMPTVVLSVQLSSLEDAGRTDVGRQR
HHNEDYFGIETKTEKLELPRNRILQARGLYILCDGMGGHAGGEVASELAVITLRQYFQQH
WTNNQLPTEEIIRESVYLANEAIYEKNQQEARSGVGRMGTTLVMLLVQGSQAAVAHVGDS
RLYRVTRKRGLEQVTVDHEVGQREIDRGVEASIAYARPDAYQLTQALGPRDETAINPDVE
FFDINEDSLLVLASDGLSDNDLLETNWQTHLLPLLSSSTNLEQGVTELIDLANQYNGHDN
ITAILVRAKVRPNLGEGTGD
Download sequence
Identical sequences A0A1W5CFT3 Q3MGA6
240292.Ava_0354 gi|75906579|ref|YP_320875.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]