SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|75906615|ref|YP_320911.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75906615|ref|YP_320911.1|
Domain Number 1 Region: 30-267
Classification Level Classification E-value
Superfamily PLP-binding barrel 1.6e-70
Family Alanine racemase-like, N-terminal domain 0.0000068
Further Details:      
 
Domain Number 2 Region: 260-393
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 2.69e-49
Family Alanine racemase 0.000085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|75906615|ref|YP_320911.1|
Sequence length 395
Comment alanine racemase [Anabaena variabilis ATCC 29413]
Sequence
MLSRQQASSMAAHQQCDTYAWFSQRAWVEIDLEALSHNVQQLKQFLSPRTQLMAVVKADA
YGHGAVTVAQTALQAGASCLGVATVPEGIQLREAGMQAPILILGATHTPEQIQAIAQWQL
QPTIGSPKQALIFSNTLETIQHDSPVPVHIKLDTGMSRLGTNWQQAGEFVQLVERLPHLN
IASVYSHLATADSPDPGIMEEQYRRFEEAIAQIKALSIKIPCLHLANSAATLADPRLHYD
MVRVGLAVYGLYPAPHLQKKISLKPVIQVQARVTHVKTIAAGTGVSYGHQFIAPHEMRLA
VVGIGYADGIPRNLSNKMQVLIRGQRVPQIGAITMDQLMIDVSALPDLQEGEIVTLLGKQ
GKEKITADDWAEELNTISWEILCGFKHRLPRVGVM
Download sequence
Identical sequences A0A1W5CFJ7 Q3MG70
gi|75906615|ref|YP_320911.1| 240292.Ava_0390

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]