SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|75906778|ref|YP_321074.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75906778|ref|YP_321074.1|
Domain Number 1 Region: 8-92
Classification Level Classification E-value
Superfamily TPR-like 0.0000000237
Family BTAD-like 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|75906778|ref|YP_321074.1|
Sequence length 173
Comment hypothetical protein Ava_0555 [Anabaena variabilis ATCC 29413]
Sequence
MSTESLELAKTRYQAGKFAFENGQYREAVENLEKASALVARNSRLGGEVEIWLVTAYEAA
GRTEDAIALCQQLRRHPHSETSQQARRLLYILQAPRLKRPSNWMTEIPDLGALSDNEAKT
RVMAKPRKPTEKKAPAEVEFVDLSQVNTKDNRFIWLALIMIGLTISYLVWLGF
Download sequence
Identical sequences A0A1W5CGU0 Q3MFQ7
240292.Ava_0555 gi|75906778|ref|YP_321074.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]