SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|75906804|ref|YP_321100.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75906804|ref|YP_321100.1|
Domain Number 1 Region: 556-976
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 7.89e-135
Family DNA polymerase I 0.0000000156
Further Details:      
 
Domain Number 2 Region: 373-549
Classification Level Classification E-value
Superfamily Ribonuclease H-like 7.6e-45
Family DnaQ-like 3'-5' exonuclease 0.00028
Further Details:      
 
Domain Number 3 Region: 15-162
Classification Level Classification E-value
Superfamily PIN domain-like 8.69e-44
Family 5' to 3' exonuclease catalytic domain 0.0000509
Further Details:      
 
Domain Number 4 Region: 195-309
Classification Level Classification E-value
Superfamily 5' to 3' exonuclease, C-terminal subdomain 6.43e-32
Family 5' to 3' exonuclease, C-terminal subdomain 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|75906804|ref|YP_321100.1|
Sequence length 977
Comment DNA polymerase I [Anabaena variabilis ATCC 29413]
Sequence
MSENSPSVTTTTTRPTFILVDGHSLAFRSYFAFAKGRDGGLRTKTGIPTSVCFGFLKSLL
EVMATQQPQAMAIAFDLGLPTFRHEADDTYKADRPGTPEDFVPDLKNLHELLEGFNLPIY
TAPGYEADDVLGTLAQKATAEGYKVKILTGDRDLFQLVDPEKEITVLNFSPDALKRSTNS
ITEVSTEQVKERLGVLPTQVVDFKALCGDKSDNIPGVRGIGEKTAVQLLSTYGSLDGVYK
ALNEIKGATQKKLAEGKEDAAKSQFLAKIVVDVPLEVNLEDCKLVGFDESLLIPILEKLE
FTRFLSQINDLQRRFGGTVVEVEKTEVAAIETTKFEDDDIAFYTAEETQAIQQNQPASPI
QPRIINTEAKLIELVQILQQFTNPETPVAWDTETSGLEPRDAALVGIGCCWGTEADASAY
IPLAHTKGENLSQDIVLTALRPILESADYPKTFQNAKFDRLVFLVQGINLTGVVFDPMLA
SYVLNPDTSHNLTDLTQRYLGLTIQNYVDLVPKGKTIADINISAVANYCCLQVYATFQLV
AKLREELAKTPNLDKLLREVEQPLESVLATVEYTGVRIDSAYLHELSQQLEIDLAKLQEQ
ATELAGEKFNLGSPKQLSYILFEKLGLSTKYSRKIQTGYSTDAATLEKLQEVDETGFVNA
ITEYRTLSKLKSTYVDALPALVRPDTQRVHTDFNQTATSTGRLSSSNPNLQNIPIRTAFS
RQIRKAFLPKSGWLMAAADYSQIELRILAHLSQEPLLVQAYQQNEDIHTVTAKLVFEKDD
INSDERRIAKTINFGVIYGMGSLKFSRSTGIDKNVANEFIKRFNERYAKIFAYLEGVKKQ
AISLGYVETILGRRRYFNFDSTSLLNLKGSNPEDIDLSKLKNLGAKDAGLLRSAANAPIQ
GSSADIIKIAMVQIHEVLKKYQARLLLQVHDELVFEVPPQEWAELQPQIKSVMENAVKLS
VPLVVDVRAGENWMETK
Download sequence
Identical sequences A0A1W5CGX8 Q3MFN1
gi|75906804|ref|YP_321100.1| 240292.Ava_0581

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]