SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|75906885|ref|YP_321181.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75906885|ref|YP_321181.1|
Domain Number 1 Region: 7-142
Classification Level Classification E-value
Superfamily CheY-like 5.27e-30
Family CheY-related 0.0019
Further Details:      
 
Domain Number 2 Region: 143-312
Classification Level Classification E-value
Superfamily GAF domain-like 3.49e-21
Family GAF domain 0.0038
Further Details:      
 
Domain Number 3 Region: 333-508
Classification Level Classification E-value
Superfamily PP2C-like 0.000000000196
Family PP2C-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|75906885|ref|YP_321181.1|
Sequence length 557
Comment response regulator receiver (CheY) and GAF modulated serine phosphatase [Anabaena variabilis ATCC 29413]
Sequence
MTETKVEKLKLMVVDDEPDNLDLLYRTFRRDFHVYKANHARKALEILAQEGEMAVIISDQ
RMPEMNGTEFLSLTVEKFPDTIRILLTGFTDVEDLVEAINSGQVFKYITKPWNPERLKNL
VEQATDTYRLVKKRTHELRRSLRRESLFNAVTTAIRESLDYESMLQKIAATIGQTFEATC
CLLKPVENNRLTANQFYYRNPAYNLPDSAFDPTTLIAQVLETGHYQIAQDIYNDNPCNYL
VVPLSYQQHLLAVLALYQWGREHPWQDEDIQLITGVAEQAALAVSQAKLYQRLQEKQQQI
SAELEVARQIQNNLLRQTLPDIKSAKLQACCYPAREVGGDFFEIFVHPTKGDVWLAVGDV
SGKGVPAALFMASAISVLRRELAQEIPAEPNVVIHNLNHALCDDLISNNCFITFVLARYT
PTTRELVYANAGHIYPLVWSNQTAPEKPNYLTVRGIPLGILPKWQAKSGSLILAPGDTLL
LASDGITEAMVSNSLFETVKTVGGVQPATHSMLNQDGLWQLLQKEPQPLSLNHLLSRIQA
DNHVQEDDQTILSLEVL
Download sequence
Identical sequences A0A1W5CGP6 Q3MFF0
240292.Ava_0662 gi|75906885|ref|YP_321181.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]