SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|75906928|ref|YP_321224.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75906928|ref|YP_321224.1|
Domain Number 1 Region: 83-177
Classification Level Classification E-value
Superfamily Ribosomal protein L6 8.9e-36
Family Ribosomal protein L6 0.0000394
Further Details:      
 
Domain Number 2 Region: 1-82
Classification Level Classification E-value
Superfamily Ribosomal protein L6 1.15e-25
Family Ribosomal protein L6 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|75906928|ref|YP_321224.1|
Sequence length 182
Comment 50S ribosomal protein L6 [Anabaena variabilis ATCC 29413]
Sequence
MSRIGKRPITVPAKVQVTIDGTKVVVKGPKGELSRELPVNVSVSQEGETLQVTRRDETRT
SRQLHGLSRTLVANMVEGVSQGFQRRLEIQGVGYRAQVQGRNLILNMGYSHQVQIEPPDG
IQFAVENNTNVIVSGYDKEIVGNTAAKIRAVRPPEPYKGKGIRYAGEVVRRKAGKTGKGG
KK
Download sequence
Identical sequences A0A1W5CGK6 Q3MFA7
240292.Ava_0705 gi|75906928|ref|YP_321224.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]