SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|75907020|ref|YP_321316.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75907020|ref|YP_321316.1|
Domain Number 1 Region: 6-161
Classification Level Classification E-value
Superfamily RNase III domain-like 5.41e-35
Family RNase III catalytic domain-like 0.00054
Further Details:      
 
Domain Number 2 Region: 119-237
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 1.14e-21
Family Double-stranded RNA-binding domain (dsRBD) 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|75907020|ref|YP_321316.1|
Sequence length 242
Comment ribonuclease III [Anabaena variabilis ATCC 29413]
Sequence
MTLVYPRRQRQLESLVRKLGLPTTAPIKWELLDLALTHPTVSESANYEQLEFVGDAVVRL
AAAVMLWETYPDCPVGDFAAIRSVLVSDRILAQLAREYGLELHLLVAGSATSDKIGQESR
LADAFEAVLGALYLSTSNLELIRPWLDHHFRQLAAEIRLDPARLNYKAALQEWTQAQFKV
LPEYRVVEINQANRTQERFAAEVWLHGNKLGEGKGRSIKAAEQAAAKVAFLAITPPEEMS
GQ
Download sequence
Identical sequences A0A1W5CGK8 Q3MF15
240292.Ava_0797 gi|75907020|ref|YP_321316.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]