SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|75907135|ref|YP_321431.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75907135|ref|YP_321431.1|
Domain Number 1 Region: 61-325
Classification Level Classification E-value
Superfamily PLP-binding barrel 6.02e-76
Family Alanine racemase-like, N-terminal domain 0.00000689
Further Details:      
 
Domain Number 2 Region: 299-460
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 1.21e-50
Family Eukaryotic ODC-like 0.0000294
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|75907135|ref|YP_321431.1|
Sequence length 464
Comment diaminopimelate decarboxylase [Anabaena variabilis ATCC 29413]
Sequence
MVSTHPAGVQDAGTQYLPQRRNTNTNISPNQELLPLTAKANSQGNLEIGGCDVTTLVEQF
GSPLYILDEETLRTACQQYRDGFQKYYPGESQVLYASKAWNCLAVCAIAGSEGLGIDVVS
GGELYTALAAGVSPAKIYLHGNNKSREELILAIESGVTIVADNWYELRTLASLTHTDQPV
RIMLRLTPGIECHTHEYIRTGHLDSKFGFDPNDLAEVFEFVSQQPNLNCVGLHAHIGSQI
FERQPHRDLAAVMVQWLRDANKYGLNVTELNVGGGLGIKYVESDDPPSIDEWVKAICEVV
QSACAAENLPLPKLLSEPGRSLIATSCVTAYTVGSSKTIPEIRTYVSIDGGMSDNPRPIT
YQSVYRAVIANKLSVSHTETVTIAGKHCESGDILIKNAQLPKTEPGDILVVMATGAYNYS
MASNYNRLPRPAAVVVANGEANLILQRETYQDLIRQDCLPERLK
Download sequence
Identical sequences A0A1W5CKG3 Q3MEQ0
240292.Ava_0912 gi|75907135|ref|YP_321431.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]