SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|75907494|ref|YP_321790.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75907494|ref|YP_321790.1|
Domain Number 1 Region: 2-142
Classification Level Classification E-value
Superfamily N-terminal domain of MutM-like DNA repair proteins 2.62e-38
Family N-terminal domain of MutM-like DNA repair proteins 0.00041
Further Details:      
 
Domain Number 2 Region: 137-226
Classification Level Classification E-value
Superfamily S13-like H2TH domain 2.5e-28
Family Middle domain of MutM-like DNA repair proteins 0.001
Further Details:      
 
Domain Number 3 Region: 226-276
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 5.7e-16
Family C-terminal, Zn-finger domain of MutM-like DNA repair proteins 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|75907494|ref|YP_321790.1|
Sequence length 277
Comment formamidopyrimidine-DNA glycosylase [Anabaena variabilis ATCC 29413]
Sequence
MPELPEVETVRRGLNQLTLNRKITGGDVLLHRTIAHPFSVGDFLNGITGDSISAWHRRGK
YLLASTTSAAWLGVHLRMTGQLLWLNQDEPLHKHTRVRIFFEDQQELRFVDQRTFGQMWW
VSSGMAVESVITGLAKLAVDPFSPEFTVEYLANKLHNRRRPIKTALLDQSVVAGLGNIYA
DEALFKSGVLPETLCTEVQLKQIELLRTAIIQVLETSIEAGGTTFSNFLNVKGVNGNYGG
VAWVYNRAGEPCKVCGDVIQRIKLGGRSSHFCRQCQV
Download sequence
Identical sequences A0A1W5CPT1 Q3MDP1
240292.Ava_1271 gi|75907494|ref|YP_321790.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]