SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|75907510|ref|YP_321806.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75907510|ref|YP_321806.1|
Domain Number 1 Region: 9-236
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.87e-61
Family G proteins 0.000000135
Further Details:      
 
Domain Number 2 Region: 308-408
Classification Level Classification E-value
Superfamily EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 3.5e-34
Family EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 0.000012
Further Details:      
 
Domain Number 3 Region: 213-311
Classification Level Classification E-value
Superfamily Translation proteins 1.63e-31
Family Elongation factors 0.0000152
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|75907510|ref|YP_321806.1|
Sequence length 409
Comment elongation factor Tu [Anabaena variabilis ATCC 29413]
Sequence
MARAKFERTKPHVNIGTIGHVDHGKTTLTAAITMTLAALGQAVAKGYDQIDNAPEEKARG
ITINTAHVEYETANRHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHI
LLAKQVGVPKLVVFLNKEDMMEDAELLELVELELRELLTEYEFDGDDIPIVRGSGLQALD
VMTKNPKTQRGENPWVDKIYELMDAVDSYIPDPERDIDKPFLMAVEDVFSITGRGTVATG
RIERGKVKVGDVVELVGIRDTRNTTVTGIEMFKKSLDEGMAGDNAGVLLRGIQKTDIERG
MVLAKPGSITPHTQFEGEVYVLTEKEGGRKTPFFAGYRPQFYVRTTDVTGTIKAFTSDEG
EAVEMVMPGDRIKVTVELINPIAIEQGMRFAIREGGRTIGAGVVSKIVK
Download sequence
Identical sequences A0A1W5CPQ6 Q3MDM5
240292.Ava_1287 gi|75907510|ref|YP_321806.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]