SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|75907658|ref|YP_321954.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75907658|ref|YP_321954.1|
Domain Number 1 Region: 106-259
Classification Level Classification E-value
Superfamily alpha/beta knot 2.22e-44
Family SpoU-like RNA 2'-O ribose methyltransferase 0.00033
Further Details:      
 
Domain Number 2 Region: 1-99
Classification Level Classification E-value
Superfamily L30e-like 3.3e-25
Family RNA 2'-O ribose methyltransferase substrate binding domain 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|75907658|ref|YP_321954.1|
Sequence length 260
Comment tRNA/rRNA methyltransferase SpoU [Anabaena variabilis ATCC 29413]
Sequence
MLTSLQNSLVKQIRKLHSTKERHKQGLFLLEGTHLLEEACAMDYPLEVVCCTPEWEASHT
ALWEEACNRCDRCEIVSEEVLQAIATTVQPDGVVATAKRSELQSQIPFTGVVLALETIQD
PGNLGTIIRTAAAAGASGLWLSQDSVDLDNPKVLRASAGQWFRLATAVSEDLKATVQLCQ
QAGMQVVATLPTAKLTYWEIDWHKPSLILLGNEGAGLSPDLAAMADQEVKIPLSPGVESL
NVAITSALMLYEVQRQLNFQ
Download sequence
Identical sequences A0A1W5CQ42 Q3MD77
gi|75907658|ref|YP_321954.1| 240292.Ava_1436

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]