SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|75907713|ref|YP_322009.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75907713|ref|YP_322009.1|
Domain Number 1 Region: 7-203
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.98e-66
Family Branched-chain alpha-keto acid dehydrogenase Pyr module 0.00000627
Further Details:      
 
Domain Number 2 Region: 187-323
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 1.18e-39
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|75907713|ref|YP_322009.1|
Sequence length 327
Comment transketolase [Anabaena variabilis ATCC 29413]
Sequence
MAETLFFNALREAIDEEMARDSSVFVLGEDVGHYGGSYKVTKDLYKKYGELRILDTPIAE
NSFTGMAVGAAMTGLRPIIEGMNMGFLLLAFNQISNNAGMLRYTSGGNFKIPLVIRGPGG
VGRQLGAEHSQRLETYFQAVPGLKIVTCSTPYNAKGLLKSAIRDDNPVLFFEHVLLYNLK
EDLPEKEYYLPLDKAEIVRSGKDVTILTYSRMRHHVTQAVKALEKQGYDPEVIDLISLKP
LDLETIGASIRKTHKVIIVEEAMRTGGIAAELIASINDRFFDELDAPVLRLSSQDIPTPY
NGTLERLTIVQPEQIVEAVQKMIALRV
Download sequence
Identical sequences A0A1W5CEL9 Q3MD22
240292.Ava_1491 gi|75907713|ref|YP_322009.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]