SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|75907788|ref|YP_322084.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75907788|ref|YP_322084.1|
Domain Number 1 Region: 1-154
Classification Level Classification E-value
Superfamily CheY-like 1.99e-35
Family CheY-related 0.00076
Further Details:      
 
Domain Number 2 Region: 189-391
Classification Level Classification E-value
Superfamily PP2C-like 0.0000209
Family PP2C-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|75907788|ref|YP_322084.1|
Sequence length 396
Comment response regulator receiver (CheY) modulated serine phosphatase [Anabaena variabilis ATCC 29413]
Sequence
MVKILVIDDDPVVRTVLKRTLENQGYETTVVNNGEEGIIQAKLLRPALIICDWVMSGLDG
LEVCRQVKANPELATSFFILLTAKGAAPGEEKDRVKGLDAGADEFISKPIEMIELKARVR
AGLRLHQLNQDLQIQKQTLEMLNHDLQTQKQTLEADLAEAADYVRSLLPKPLEGKVNTET
LFIPSTQLGGDCFDYYWLDDEHLAIYLLDVSGHGIGSALLSVSILNILRSQSLPNTNFYK
PREVLKALNHAFQMANHGDKYFTIWYGVYHCIQHQLVYASAGHPPAVILSGKPETGFQVK
RLNSLDLPIGFLPDVQFEDAIWEVKKDSTLYIFSDGIYEIREPDGKILGLDAFIEILTNS
SQKEPCNIHYILMQIMTLNIQQILEDDLSLLKITLG
Download sequence
Identical sequences A0A1W5CEM7 Q3MCU7
240292.Ava_1566 gi|75907788|ref|YP_322084.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]