SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|75907800|ref|YP_322096.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75907800|ref|YP_322096.1|
Domain Number 1 Region: 26-255
Classification Level Classification E-value
Superfamily Isochorismatase-like hydrolases 7.46e-52
Family Isochorismatase-like hydrolases 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|75907800|ref|YP_322096.1|
Sequence length 264
Comment isochorismatase hydrolase [Anabaena variabilis ATCC 29413]
Sequence
MDQSLRTLGVAPNAWMVNQAIADITRPQKTPQPVILSTETKTLRLDLAKTAIIVIDMQND
FCHPDGWLAHIGVDVTPAAKPIVPLNNLLPELRAVGVPVIWLNWGNRPDLLNISANLLHV
YNPTGEGVGLGDRLPKNDARVLMAGSWAAAVVDELQQLPQDICVDKYRMSGFWDTPLDSI
LKNLGITTILFAGVNADQCVLTTLCDANFLGYDCILVKDCTATTSPDYCWLATLYNVKQC
FGFVSDSQAIFTALNHPEATGRDK
Download sequence
Identical sequences A0A1W5CEL1 Q3MCT5
240292.Ava_1578 2005405792 gi|75907800|ref|YP_322096.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]