SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|75907958|ref|YP_322254.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75907958|ref|YP_322254.1|
Domain Number 1 Region: 8-189
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 1.33e-43
Family Phosphoglucomutase, first 3 domains 0.0013
Further Details:      
 
Domain Number 2 Region: 252-376
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 9.03e-31
Family Phosphoglucomutase, first 3 domains 0.00088
Further Details:      
 
Domain Number 3 Region: 378-473
Classification Level Classification E-value
Superfamily Phosphoglucomutase, C-terminal domain 5.49e-18
Family Phosphoglucomutase, C-terminal domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|75907958|ref|YP_322254.1|
Sequence length 475
Comment phosphoglucomutase/phosphomannomutase [Anabaena variabilis ATCC 29413]
Sequence
MSASSNSSKIKFGTDGWRGIIADDFTFPNVRKVTRAIASYLETAYTKDRPVLIAYDTRFL
ADQFAQTAAQVLADLGWNVKITDRDCPTPVIAYNARHLNSAGALMFTASHNPAPYCGIKY
IPDYAGPATPEITDTIVANIESASDELPSGKPSGSISTFDPKPDYLQFIYTLLDVEKIKS
AQLKVKYDALYSTSRGYLDEVLIESGTQLESFHTWRDVLFGGGMPEPKGEQLVELVEAVR
RDHADLGLATDGDSDRFGIVDELGNVLTPNTVLLVLARHLIKNKGKTGAIVRTVATTHLL
DNFAAKYGLTIYETAVGFKYIGEKMRETAVLIGGEESGGLSIIGHIPEKDGVLADMLIAE
AIAYEGKPLSQLVKEAIAEADGPLYNNRLDLHLTEAHKVAVIDSFTKNPPSEVAGIKVKE
VGRKDGIKLYLEEGSWVLLRPSGTEPLVRVYLETNSPEKLSKLEQELESTIAKLG
Download sequence
Identical sequences A0A1W5CCC7 Q3MCC7
gi|75907958|ref|YP_322254.1| 240292.Ava_1737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]