SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|75908057|ref|YP_322353.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75908057|ref|YP_322353.1|
Domain Number 1 Region: 131-319
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 3.71e-50
Family ATP-binding domain of peptide synthetases 0.0000778
Further Details:      
 
Domain Number 2 Region: 1-129
Classification Level Classification E-value
Superfamily PreATP-grasp domain 7.48e-37
Family Prokaryotic glutathione synthetase, N-terminal domain 0.0007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|75908057|ref|YP_322353.1|
Sequence length 324
Comment glutathione synthetase [Anabaena variabilis ATCC 29413]
Sequence
MKLAFIIDPIHQLDPCHDTSVALMEAAQILGHEVWVTQANWLSVVDSKAWAILQQVELVP
VQLVDGRWVAANPWYKLNARSLNSLETMDAVFMRTDPPVNDAYLYATYVLDYVDQQKTLV
INNPNGIRKANEKMYALQFTKAIPETIVSADKDFIRQFVEAKGATILKPLGNKAGEGILF
LQAGDRNFNSIVELSTQQGRLPVMVQTYLSEAKEGDKRIILLNGEPIGALNRLASGSDFR
NNMATGGTVAKTEITPREQEICGDLAANLRQDGLVFVGIDVIGGYLTEVNVTSPTGIREI
DRLDGTRLANQVIQWVEKNLQIQN
Download sequence
Identical sequences A0A1W5CCQ0 Q3MC28
240292.Ava_1836 gi|75908057|ref|YP_322353.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]