SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|75908107|ref|YP_322403.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75908107|ref|YP_322403.1|
Domain Number 1 Region: 557-825
Classification Level Classification E-value
Superfamily Cysteine proteinases 8.31e-44
Family Calpain large subunit, catalytic domain (domain II) 0.0025
Further Details:      
 
Domain Number 2 Region: 7-118
Classification Level Classification E-value
Superfamily Collagen-binding domain 4.97e-19
Family Collagen-binding domain 0.0036
Further Details:      
 
Domain Number 3 Region: 239-347
Classification Level Classification E-value
Superfamily Collagen-binding domain 3.53e-17
Family Collagen-binding domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|75908107|ref|YP_322403.1|
Sequence length 827
Comment peptidase [Anabaena variabilis ATCC 29413]
Sequence
MTLDNAGNTLTTARKLTVSSNIQTFADRVDSTDPNDFYSFSLSARSSLNIAVDGLSANAD
LQLIRDTNSNGLVDSGEVLNTSNKTGTGSESIRRTLDAGKYFIRVYSNTGDTNYNLKVFE
NFTPTSLEFKLNESTLKATDTLNINSGWVSDRNGISDLSKVDFRIQRANGSWIDVADATQ
FTVDPNNTNKAGFSYSLSLNSLNLAADTYTLQGIAYDKTGAASNTVRLSLTIENPGLTLT
NAKKITLSEKTQTFTDRVDSTNINDFYSFSLSARGNLNLVVDGLSASADVQIIRDANSNG
LFDGGEVVTGAYRTGSGSESIRTTLDAGNYFIRVYSQGGNTNYKLKVFENFAPTALDFKL
NNTSLKPTDTLSINSAWVSDKNGVSDISKVDFRIQKADGSWIDVADATKFTADSSNANKA
SFSYSLSLSSLNLAVGTYTLQGIAYDKTNAASNTVKQTFTVTTTPTTTASATVQDWFSQN
LLDQQLITLTRNLAADGNLSRQDMLDIFRNVQDDSKVDANEVKDLRTLVGASTRFSMQDP
VKWLSTQVANGASVDMAASDFESSLVGRWFLGTVAPTPVFNGKTLTYTLATGNLFGSANE
ARIGDIDQGQLGDCAFLAALGATFGRQSNDAGNASSSVINSMITDNGDNTYTVRFYSTTI
FDPGEAQYVTIDRRIATSVAAKTNGGVLWVALVEKAYAQWREWREGKPGYNIIGNGDALS
RPLQFVTGRDFTPADPTNINCFSTIETALANGKAVTAARMGDSTSYIVGNHAYSVTNVYT
NTSGEKRFVVRNPWGKDGKTRTGADDGFIDLSFDEFSKAFNYGVIIA
Download sequence
Identical sequences A0A1W5CCT9 Q3MBX8
gi|75908107|ref|YP_322403.1| 240292.Ava_1886

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]