SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|75908282|ref|YP_322578.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75908282|ref|YP_322578.1|
Domain Number 1 Region: 6-234
Classification Level Classification E-value
Superfamily Ribosomal protein S2 5.49e-97
Family Ribosomal protein S2 0.00000053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|75908282|ref|YP_322578.1|
Sequence length 265
Comment 30S ribosomal protein S2 [Anabaena variabilis ATCC 29413]
Sequence
MPVVSLAQMMESGVHFGHQTRRWNPKMSPYIYTSRNGVHIIDLVQTAHLMDEAYNYMRSQ
AEQGKKFLFVGTKRQAAGIIAQEAARCGSHYINQRWLGGMLTNWATIKTRVDRLKDLERR
EESGALDLLPKKEASMLRRELAKLQKYLGGIKTMRKVPDVVVIVDQRREYNAVQECQKLS
IPIVSMLDTNCDPDVVDIPIPANDDAIRSIKLIVGKLADAIYEGRHGQLDVEEEYEDYEG
AEDDYEYDETEYTDSVIPDDEEEAE
Download sequence
Identical sequences A0A1W5CHD7 Q3MBF3
gi|75908282|ref|YP_322578.1| 240292.Ava_2061

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]