SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|75908311|ref|YP_322607.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75908311|ref|YP_322607.1|
Domain Number 1 Region: 14-422
Classification Level Classification E-value
Superfamily Clc chloride channel 1.57e-73
Family Clc chloride channel 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|75908311|ref|YP_322607.1|
Sequence length 434
Comment VWA containing CoxE-like protein [Anabaena variabilis ATCC 29413]
Sequence
MLPNKRTPTNQAQRWKFLQLFGLVRRNPLLISRWVLRWVMVGTVCGLFAGLYWNVLELMT
HQLERFESVSLLIVMPIAGLIVGLVIHFLGNPGEIAVIVDNIHFRGGRLDIRKNPAMILA
SLVSIAGGGSAGPEAPLVQVTGSFGTWVGDRLGLQGEDMRSMSLAAMAAGFTALFGAPLG
GAMFALEILHHQHIIEYYEALMPAIVSSCASYLVFALITHLGIAPTWHFPEYNLENMDDF
AWAILFGIIGAVAGWIFMTIFRTCDRLWAMLPVPVYIRTTLAGLGLGTLAIFLPLTRYFG
HQELESVLNTNFSVVFLLILALGKMASISLTVTGGWRGGFIIPLFFTGACVGKAIAILIP
GLNPTLAMICTMSALNAGVTRTPISTTLLLSKLTNFSPFTPILFASLIGFFLAPKVPLIA
SQLKSQQSIEEIQS
Download sequence
Identical sequences A0A1W5CHB1 Q3MBC4
gi|75908311|ref|YP_322607.1| 240292.Ava_2090

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]