SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|75908314|ref|YP_322610.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|75908314|ref|YP_322610.1|
Domain Number - Region: 93-160
Classification Level Classification E-value
Superfamily Nitrous oxide reductase, N-terminal domain 0.0445
Family Nitrous oxide reductase, N-terminal domain 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|75908314|ref|YP_322610.1|
Sequence length 235
Comment sugar transferase [Anabaena variabilis ATCC 29413]
Sequence
MSVPDFTPKPERFTMDRLAIVNHPMNADFLQQPVHYSAISVRKRLIDIIGAIVGLIITAI
ITVPIAILTIINDPGPIFYSQIRCGLNGRHFRIWKFRSMVVNADKVKHLVKNQAQGHIFK
SVNDPRITPMGRFLRRTSLDEFPQFWNVLKGDMSLVGTRPPTPDEVVHYEPRHWERLRVK
PGMTGEWQTKGRSNIKDFETIVQMDLDYQRKWSITYDLSLILKTVWVVLKKSGAC
Download sequence
Identical sequences A0A1W5CH53 Q3MBC1
240292.Ava_2093 gi|75908314|ref|YP_322610.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]