SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|75908381|ref|YP_322677.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75908381|ref|YP_322677.1|
Domain Number 1 Region: 5-424
Classification Level Classification E-value
Superfamily Clc chloride channel 5.49e-104
Family Clc chloride channel 0.00000181
Further Details:      
 
Domain Number 2 Region: 434-557
Classification Level Classification E-value
Superfamily CBS-domain pair 1.06e-33
Family CBS-domain pair 0.00066
Further Details:      
 
Domain Number 3 Region: 588-719
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 2.85e-21
Family Universal stress protein-like 0.0076
Further Details:      
 
Domain Number 4 Region: 729-857
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 0.00000000072
Family Universal stress protein-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|75908381|ref|YP_322677.1|
Sequence length 862
Comment VWA containing CoxE-like protein [Anabaena variabilis ATCC 29413]
Sequence
MYFRSWLQPRRGLAIAEACVIGVLAALSAVFLKVCSGLLGAWRVHSSHVLPAWVVLPIIG
LGFGYLAGLMVQRLAPEAAGSGIPQVKATLANIPMKLSWRVAVIKLLSAIIALGSGITLG
RQGPTVQVGAGLASGMSRLVPTSPDHRRQMIAAGAGAGLAAAFNAPIAGVLFIIEELLQD
LSGLTLGTAIIASFIGGVVSRLLGGRSLNLNIELLSYSSRFTFPEIPFFLLLGVLAGLLG
ALFNRGLIFSLQFYRSLHISLPLRVGLAGLVSGIVVSLLPESFRDNAGLREYVITGDLNP
SFAAIAFVAQFTLTLVAFGSGAPGGLFAPSLILGSALGHLVGVLEYQITGDGSPVTYALA
GMGGFFSAVSKVPITAIVIIFEMTTDFNLVLPLMIVSVTAYLVADKVVPGSLYEKLLLLN
GITLTKQMSVEGILSQMTAKDVMQQRVETLDADITLEEAKQAFASSHHRGFPVVEDNKLV
GIITQSDLTKSLSRNLENHPHLREIMTANPMTVTPIHTLSNVLYLLDRYQISRLPVVDGQ
KLIGIITRADIIRVEADRLNCENPNPGPQPEPSYVVYQTRSPSTGRGRILVPVANPETAA
TLLKMAAAIARDRHYEIECVQVMLVSRHSSPSETTVRTAKSRRLLRQAEVLAKKWRIPLH
TQIRVAHDPAHAILETIKDRHIDLILMGWKGSTSTPGRIFGNVVDTIIRQATCDVVLVKL
GTSPIPNPPFNRWLVPMAGGPNARIAIKLLPALVTLSDDPQIRLTRVFKPWEFRPDMTVL
EQAIRQLMRRRQLSSTVIAAPVQADSVVEGVIKLVKTEGYDVVVLGASREGLLQQAIQGN
IPEAIASGVDITVILVRGAIES
Download sequence
Identical sequences A0A1W5CG39 Q3MB54
240292.Ava_2162 gi|75908381|ref|YP_322677.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]