SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|75908402|ref|YP_322698.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75908402|ref|YP_322698.1|
Domain Number 1 Region: 1102-1390
Classification Level Classification E-value
Superfamily WD40 repeat-like 3.11e-98
Family WD40-repeat 0.0000136
Further Details:      
 
Domain Number 2 Region: 941-1180
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.08e-82
Family WD40-repeat 0.0000227
Further Details:      
 
Domain Number 3 Region: 1314-1527
Classification Level Classification E-value
Superfamily WD40 repeat-like 7.32e-70
Family WD40-repeat 0.0000226
Further Details:      
 
Domain Number 4 Region: 435-630
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000661
Family Extended AAA-ATPase domain 0.054
Further Details:      
 
Domain Number 5 Region: 3-160
Classification Level Classification E-value
Superfamily Caspase-like 0.000000105
Family Caspase catalytic domain 0.033
Further Details:      
 
Domain Number 6 Region: 901-936
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 0.0000235
Family Pentapeptide repeats 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|75908402|ref|YP_322698.1|
Sequence length 1557
Comment peptidase C14 [Anabaena variabilis ATCC 29413]
Sequence
MSRDALVVGINKYSFAGLSGLKSPAKDAEAIAKRLSEAGNFHVKRSPQFLDPFEDHAPRV
AANQELKLADLEKALEELFYPEGRSIPDTALFYFSGHGLRKEGRIKEGYLATSDTNPDVG
NWGLRLKWLRELLQESPVRQQIIWLDCCYSGELLNFTEADPGDRGNTRDRCFIAASREFE
PAYENVGGASSLLTSAILRGFDLADVSNQWVTNETLVAFLREELKTAPQKFISNNLGCIN
IIFRAETTKKQAVQPVTPTANQPNQTAKLAEQLRAWFTALRYDFEQYEINNETYFEWIIN
VINPVGRKRYNRILVRGITGEAEMKDVAALRQSVNAQRTDIGWLITNRRVSRAAKDEVSK
QENQDLFCYTLDELLDRDADFSCYLNWLEDEIKQRGIDRTYVPLACTKEEFDPISKQKMG
MSRYAQADGWIDGYVDRWLDDPAKEHLSILGEFGTGKTWFGLHYAWTTLQRYRDAQRRGV
ERPRLPLVIPLRDYAKAVSVESLFSEFFFRKHEIPLPGYSAFEQLNRMGKVLLIFDGFDE
MAARVNRQEMINNFWELAKVVVPGAKVILTCRTEHFPEAKEGRALLSAELQASTINLPLE
TPRFEVLELEKFDDEQIRQVFGFRAEAETVEQVMNNSTLRDLARRPVMTELIIEALPEIE
AGKPVDISRVYLYAVRHKMERDIKAERTFTSLADKLYFLCELSWEMLSQDQMSMNYKEFP
DQIRRLFGSVVEEEKDLDHWHYDMMGQTMLIRNAEGDYSPAHRSLLEFFAAYKLVAELGV
LAPDFTELAQAQSCLDKTVPARDYTWSEYFQRQCQEDGQLLPIAPIKSFTNASLERLCNY
LGTSPLAKALLDLAVPMLDEQVFQQILLRLIQATRGKTQAQVGYIGGNLVKLLIERNPYS
LENCDLSNTVIPDVNFANASFRWVNLMGTNLTNSVFAPVLGVVYSVAFSPDGKKLVIGDS
KGTIQVWETFSGRVLLFLQGHENGVKSVAFSPDGGRIVSGSNDNTIRLWDVNGQPIGQPF
RGHEGGVNSVAFSPDGGRIVSGSNDNTIRLWDVNGQPIGQPFRGHEGGVNSVAFSPDGGR
IVSGSNDNTIRLWDVNGQPIGQPFRGHEGGVNSVAFSPDGGRIVSGSYDNTVRLWDVNGQ
PIGQPFRGHEGGVNSVAFSPDGGRIVSGSNDNTIRLWDMNGQPIGQPFRGHEDMVYSVAF
SPDGGRIVSGSYDKTIRLWDMNGQPIGQPFRGHEDMVLSVAFSPDGGRIVSGSYDNTVRL
WEANGQSIGQPFRGHENLVNSVAFSPDGGRIVSGSNDNTIRLWDVNGQPIGQPFRGHEGR
VYSVAFSPDGGRIVSGSNDNTIRLWDVNGQPIGQPFRGHENLVYSVAFSPDGGRIVSGSW
DNTIRLWDVNGQPIGRPFRGHENVVYSVAFSPDGGRIVSGSWDNTIRLWDVNGQSIGQPF
RGHEDWVRSVAFSPDGGRIVSGSDDKTLRLWDVNGQPIGQPFRGHEDLVRSVAFSPDGER
IVSGSYDETIRIWDAATGDCLRVISYKLCAGLNITGVTGLTSAQRVALKLMGAIDNL
Download sequence
Identical sequences Q3MB33
240292.Ava_2183 gi|75908402|ref|YP_322698.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]