SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|75908438|ref|YP_322734.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75908438|ref|YP_322734.1|
Domain Number 1 Region: 205-400
Classification Level Classification E-value
Superfamily PheT/TilS domain 3.14e-63
Family B3/B4 domain of PheRS, PheT 0.00000701
Further Details:      
 
Domain Number 2 Region: 36-193
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 7.35e-48
Family Myf domain 0.0012
Further Details:      
 
Domain Number 3 Region: 486-699
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 9.44e-44
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000974
Further Details:      
 
Domain Number 4 Region: 711-809
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 3.01e-32
Family Anticodon-binding domain of PheRS 0.00034
Further Details:      
 
Domain Number 5 Region: 415-493
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.0000000000000751
Family Domains B1 and B5 of PheRS-beta, PheT 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|75908438|ref|YP_322734.1|
Sequence length 810
Comment phenylalanyl-tRNA synthetase subunit beta [Anabaena variabilis ATCC 29413]
Sequence
MRISLNWLRELVEIKLSPEELAHILTMAGFEVEDIEDRRTWANGVVVGRVLERQPHPNAD
KLSVCQVDVGATETLNIVCGAPNVRADIYVPVATVGAYLPNIDLKIKPAKLRGVPSQGMI
CSLKELGLPSEVDGIYIFPQENLPLGSDVRPLLGLDDVILDVTATANRADALSMVGIARE
VAALTDAKLSIPKPGEAFVSESVGKLGLKIADTQACPAYIGTVIEQVKIASSPEWLQQRL
RSAGVRPISNVVDITNYVLLEWGQPLHAFDQERLKSVANADNLTIGVRCANQGETLKTLD
GQTRNLTTQNLLITANDQPVALAGVMGGEETEVHEGTQSLILEAALFDSVAIRRSSRSVG
LRSEASGRYERGVNRAELEIANRRALSLISELADGVIVHQEIADTRPDPTTWSRSIFLRL
DRVNEVLGPINVGETGELEAKDVERTLTALGCELTPAGEGTWNVSVPPYRYRDLEREIDL
IEEVARLYGYDNFCDTLPDKAEAGYLPVDQELVRKLRAALRAEGLTELIHYSLVKPGEDR
QIVLSNPLFVEYSALRTDLLAGLIDAFQYNLEQGNGSLNGFEIGRIFWQEEDGLQEKDAI
AGIIGGDTSLGKWSKGSKDQPLTWFEAKGILESVFQQLGILVEYQPDCRDERLHPGRTAS
LWIGGNRLGIFGQLHPQLRRDKDLPESVYVFQLDLDVLLDALDKDEILVPAFKPYSTYPA
SDRDIAFFAPVKISVSEIEKAINKAGKGLLESVELFDEYRGENVPQGQRSLAFRLVYRAS
DRTLTDTEVEPVHNKVREALVEKFGVNLRS
Download sequence
Identical sequences A0A1W5CN85 Q3MAZ7
240292.Ava_2221 gi|75908438|ref|YP_322734.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]