SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|75908474|ref|YP_322770.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|75908474|ref|YP_322770.1|
Domain Number - Region: 86-156
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase N-terminal domain-like 0.0789
Family NadC N-terminal domain-like 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|75908474|ref|YP_322770.1|
Sequence length 250
Comment red chlorophyll catabolite reductase [Anabaena variabilis ATCC 29413]
Sequence
MLEQQLSVENTARFEQLWSITKELRQKLDARFELRLNESTKDLQNYSAQVGAAHGSLNTF
SGAEIDWLVHSWMREPISGFCNMHLTVWLGSQIRVPHLAFAFATVPNLFFYMDYVSRSDL
LTDLDYLDRYYEPANERYLTFLKDDRFQQYHSKTLYIRQVQSQTSLCYTSQITDETIATL
RSTAHEMIDRWLGWVDEAEPVPESERAALAQRDLIVRRAIAERDPDNKIAVKLFGEYMTD
KLVRSLWGDN
Download sequence
Identical sequences A0A1W5CCD1 Q3MAW1
gi|75908474|ref|YP_322770.1| 240292.Ava_2257

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]