SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|75908599|ref|YP_322895.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75908599|ref|YP_322895.1|
Domain Number 1 Region: 174-385
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 3.26e-82
Family ATP sulfurylase catalytic domain 0.00000269
Further Details:      
 
Domain Number 2 Region: 8-171
Classification Level Classification E-value
Superfamily PUA domain-like 4.08e-54
Family ATP sulfurylase N-terminal domain 0.0000377
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|75908599|ref|YP_322895.1|
Sequence length 392
Comment sulfate adenylyltransferase [Anabaena variabilis ATCC 29413]
Sequence
MSQHPEAIAAHGGQLVNRVATPAQREEFVSKAEFLPRVQLDERAVSDLEMIAIGGFSPLT
GFMNQEDYDRVVSEMRLANGLVWSIPITLSVSEEVASSLQEGGLVRLDNPAGDYIGVLQL
TQKYRYDKTREAINVYRTDDAKHPGVQVLYNQGAVNLAGDIWLLERSSHPLFPDYQIDPV
ASRQMFRDKGWKTIVGFQTRNPIHRAHEYIQKCALETVDGLFLHPLVGATKEDDIAADVR
MRCYEILLEHYYPEDRVILAINPAAMRYAGPREAIFHALVRKNYGCTHFIVGRDHAGVGD
YYGTYDAQYIFDEFEPGELGIVPMKFEHAFYCTRTKQMATTKTSPSRPEERVHLSGTKVR
EMLRRGELPPPEFSRPEVAAELARAMRVQVLA
Download sequence
Identical sequences A0A1W5CBZ7 Q3MAI6
240292.Ava_2382 gi|75908599|ref|YP_322895.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]