SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|75908625|ref|YP_322921.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|75908625|ref|YP_322921.1|
Domain Number - Region: 48-116,179-213,247-326
Classification Level Classification E-value
Superfamily Isochorismatase-like hydrolases 0.000105
Family Isochorismatase-like hydrolases 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|75908625|ref|YP_322921.1|
Sequence length 340
Comment hypothetical protein Ava_2409 [Anabaena variabilis ATCC 29413]
Sequence
MQLPIPPHFNSAKVGEVWRVPYQERAAEAEAWAKQHNIQPAAFDKTRICLLLIDVQNTFC
IPEFELFVGGESGTGAVDDNRRICEFIYHNLGLITKIIPTLDTHTAMQIFHPIFWVNELG
EHPTPAATSITLTDIEKGIWKVNPDVANSITHGDYELLEKHAYHYVKQLSQDGKYPLTVW
PYHSMLGGIGHALVSAVEEAIFFHGIARHSQTQFEIKGDNPLTENYSVLRPEVLVGFDKN
PLADKNQKLIKQLLEFDAVIIAGQAKSHCVAWTIDDLLTEIQQVDTALAKKVYLLEDASS
PVVVPGVVDYTEQADAAFAKFQAAGMQIVKSTEPIDKWLQ
Download sequence
Identical sequences A0A1W5CBW3 Q3MAG0
gi|75908625|ref|YP_322921.1| 240292.Ava_2409

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]