SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|75908703|ref|YP_322999.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75908703|ref|YP_322999.1|
Domain Number 1 Region: 1-362
Classification Level Classification E-value
Superfamily Dehydroquinate synthase-like 1.83e-111
Family Iron-containing alcohol dehydrogenase 0.00000000227
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|75908703|ref|YP_322999.1|
Sequence length 384
Comment Iron-containing alcohol dehydrogenase [Anabaena variabilis ATCC 29413]
Sequence
MENFVFYNPVKILFGKGQIANIAAEIPTDAKILITYGGGSIKANGVYDQVKSALTGRNVF
EFGGIEPNPHLETLLQAVELVRQEGIDFLLAVGGGSVVDGTKFIAAAVPFVGDPWDILAK
QAPVTAAVPFGAVLTLPATGSEMNTNSVVTKWETKEKLFFASPLVFPRFSVLDPETTFSL
PPRQIGNGIVDAYTHVMEQYLTYSVNAPLQDRWAESILKTLIEEGPKTLANPTDYDARAN
LVWAATLALNGLIGAGVPQDWATHMIGHELTALHGLDHAQTLAIVLPSTLSIRRDRKWQK
LLQYAERVWNIVDGSEEERVNEAIAKTRNFFESVGVRTRLSDYGVGLETIPLVVENLQKH
GLANLGEHKDVDSQVVEQILTLSA
Download sequence
Identical sequences A0A1W5CCX7 Q3MA82
240292.Ava_2489 gi|75908703|ref|YP_322999.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]