SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|75908755|ref|YP_323051.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75908755|ref|YP_323051.1|
Domain Number 1 Region: 161-368,406-562
Classification Level Classification E-value
Superfamily YVTN repeat-like/Quinoprotein amine dehydrogenase 2.04e-19
Family YVTN repeat 0.011
Further Details:      
 
Domain Number 2 Region: 38-212
Classification Level Classification E-value
Superfamily Nitrous oxide reductase, N-terminal domain 0.000000000288
Family Nitrous oxide reductase, N-terminal domain 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|75908755|ref|YP_323051.1|
Sequence length 592
Comment alkaline phosphatase-like protein [Anabaena variabilis ATCC 29413]
Sequence
MSNKTPPAFISGLWGSFRATNLWHNINKSGISYYIQTMTIQKLIAIIAPSFILLGAMLAP
AEATTLKPIGTYSTGLFEQGGAEIPAYDPVSQRLFVVNGGTSSIDVISISDPTKPSFLFN
IGIQDYGRGVNSVAFKNGLLAAAIEDFTPQNPGKAVFFDVNGNLINSVNVGALPDMLTFT
PDGKRVLVANEGEPNTNYTVDPEGSVSIINIADFSVIHAGFSQFNSQIDQLRAGGVRIFG
PNATVAQDLEPEYITVSPDSTKAWISLQENNAIATLDLITNEITNINPLGFKDHSLPGNG
FDASDRDNAINISNWPVLGMYQPDGIASYTVNGKTYIVTANEGDARDYAGFSEVVRLGSN
QYLLDPTVFPNASVLKNTANLGRLNVTRTLGDENKNGSFEKIYSYGARSFSIWESDQTTG
KLKLVFDSGDQFEQIIAQRLPAFFNSNNTENSFDTRSDDKGPEPEDVKIAKINGRFYAFV
GLERVGGVMVYDITNPAKPVFVDYANNRDFTVPLQNPGGKTNPLAGDLGPEGLLFISAAD
SPNQKPLLITANEISGTTTIYSLDIETVPEPGTMLALGAVVSTTILRVKRKR
Download sequence
Identical sequences Q3MA30
240292.Ava_2541 gi|75908755|ref|YP_323051.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]