SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|75908765|ref|YP_323061.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75908765|ref|YP_323061.1|
Domain Number 1 Region: 26-147
Classification Level Classification E-value
Superfamily N-utilization substance G protein NusG, N-terminal domain 8.63e-34
Family N-utilization substance G protein NusG, N-terminal domain 0.00012
Further Details:      
 
Domain Number 2 Region: 138-209
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 2.41e-17
Family N-utilization substance G protein NusG, C-terminal domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|75908765|ref|YP_323061.1|
Sequence length 210
Comment transcription antitermination protein NusG [Anabaena variabilis ATCC 29413]
Sequence
MTSATDEPTNSALQSEETAETALTEARWYAVQVASGCEKRVKTNLEQRIQTFDVAEKIVQ
VEIPHTPAVKIRKDGSRQHTEEKVFPGYVLVRMVMDDDTWQVVRNTSHVINFVGAEQKRG
TGKGRGHVKPLPLSHSEVERIFKQTTEQEPIVKIDMASGDKIIVLSGPFKDFEGEVIEVS
PERSKLKALLSIFGRDTPVELEFNQVEKQS
Download sequence
Identical sequences A0A1W5CGW9 Q3MA20
gi|75908765|ref|YP_323061.1| 240292.Ava_2551

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]