SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|75908830|ref|YP_323126.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75908830|ref|YP_323126.1|
Domain Number 1 Region: 85-236
Classification Level Classification E-value
Superfamily F1F0 ATP synthase subunit A 3.14e-35
Family F1F0 ATP synthase subunit A 0.00075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|75908830|ref|YP_323126.1|
Sequence length 251
Comment F0F1 ATP synthase subunit A [Anabaena variabilis ATCC 29413]
Sequence
MLNFLNFYSVPLAELEVGKHLYWQIGNLKLHGQVFLTSWFVIGVLVLASVAASSNVKRIP
SGIQNLLEYALEFIRDLAKNQIGEKEYRPWVPFVGTLFLFIFVSNWSGALVPFKLIHLPE
GELAAPTSDINTTVALALLTSLAYFYAGFSKKGLGYFGNYVQPVSFMLPFKIIEDFTKPL
SLSFRLFGNILADELVVGVLVLLVPLFVPLPVMALGLFTSAIQALIFATLAAAYIGEAME
DHHGEEHEEHH
Download sequence
Identical sequences A0A1W5CIP5 Q3M9V5
240292.Ava_2616 gi|75908830|ref|YP_323126.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]