SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|75908870|ref|YP_323166.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75908870|ref|YP_323166.1|
Domain Number 1 Region: 7-111
Classification Level Classification E-value
Superfamily DOPA-like 5.62e-41
Family DOPA dioxygenase-like 0.0000655
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|75908870|ref|YP_323166.1|
Sequence length 120
Comment DOPA-dioxygenase-like protein [Anabaena variabilis ATCC 29413]
Sequence
MKEESLNITGFHAHVYFDSASFATAMSIREELGNRFNVQLGRSHEKPIGPHPKSMYQVAF
PSTEFAQIVPWLMLHRQELDILVHPLTGDDVSDHTRFALWLGEKLELNIDSLRKVIPANE
Download sequence
Identical sequences A0A1W5CQC1 Q3M9R5
gi|75908870|ref|YP_323166.1| 240292.Ava_2658

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]