SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|75909029|ref|YP_323325.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75909029|ref|YP_323325.1|
Domain Number 1 Region: 732-838,885-1110
Classification Level Classification E-value
Superfamily WD40 repeat-like 8.79e-98
Family WD40-repeat 0.0000122
Further Details:      
 
Domain Number 2 Region: 572-868
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 6.67e-96
Family Quinoprotein alcohol dehydrogenase-like 0.019
Further Details:      
 
Domain Number 3 Region: 105-376
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.04e-30
Family Nitrogenase iron protein-like 0.052
Further Details:      
 
Domain Number 4 Region: 1097-1172
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 0.00000412
Family SGL-like 0.059
Further Details:      
 
Weak hits

Sequence:  gi|75909029|ref|YP_323325.1|
Domain Number - Region: 532-567
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 0.000209
Family Pentapeptide repeats 0.02
Further Details:      
 
Domain Number - Region: 33-64
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.063
Family ReutB4095-like 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|75909029|ref|YP_323325.1|
Sequence length 1196
Comment WD-40 repeat-containing protein [Anabaena variabilis ATCC 29413]
Sequence
MKQQKARRNRGVTLTLQGWDKLQAAKAKAEWEKNGGDSFSLEELSDRTRLALHTISRILA
RLEPVDKSSLQLAFAAFNLELSPSDYTRPTSTVEELETRQGNPQYDWAEAPDVSVFFGRS
EELLQLRQWVLEERCRLVGLLGIGGIGKTTLAVKLGLQIQAEFEVVVWRSLQNAPPVDEQ
VTNILQSLLSALQKEMVIPESFDGKLVKLMECLHSNRCLLILDNFETILSGGQAGQCRPG
YEGYGQLLKRIGEVPHISCLLFTSREKPREIVPLEGERTGAKSLPLKGLNTTEGQELFQQ
KGQFTGTEQEWQLLIEHYGGNPLALKMVAAGTQELFDGRIAPVLEYVEHGILIFEDIGDL
LERQFYHLSPVETEVMYWLAINREPVSLAELVADIVTSSSQRLVPSAINSLLQRSLIERS
GKYFFLQPVVMEYTTQRLVQQIRQQLLGEKSARLGLFQTHALIKATSKDFIRETQRQLIV
QPLLEQLLLEMGSQEQLIILLQNILEQQRHQTAILTGYAGGNILNFLAHLQVNLREYDFS
NLCMRQADLQRINLAGVNFQNTAFDQSAFATSLKNIFSLALSPDRKLLATGDQDGQIHLW
QMANRKNLLTFKGHECVVWTVAFSPDGQTLASGGHDGLIKLWDVQTGNCLKTLAQHEGIV
WSVRFSPDGQTLVSGSLDASIRLWDIRRGECLKILHGHTSGVCSVRFNPDGSILASGSQD
CDIRLWDLNTDKCIKVLQGHAGNVRAVCFSPDGKTLASSSSDHSVRLWNVSKGTCIKTFH
GHKNEVWSVCFSSDGQTIATGSYDSSVRLWDVQQGTCVKIFHGHTSDVFSVIFSSDRHIV
SAAQDFSVRIWNISKGVCVRTLQGHSCGAFSVSFNSVCPTGVDCMLATGSMDGLVRLWDV
ASGYCTKILQGHTNWVWSVSFSPDGSILASGSHDKSIKLWDVISGHCITTLYGHNGGVTS
VSFSPDGQTLASASRDKSVKLWDIHERKCVKTLEGHTGDIWSVSFSPDGNTLATASADYL
VKLWDVDEGKCITTLPGHTDGVWSLSFSPDGKILATGSVDHSIRLWDTSNFTCLKVLQGH
TSTIWSVSFSPNGSTLASASSDQTIRLWDMNNFTCVRVLDSHTSGGCAVSFNSVGNILVN
TSQDEVIKLWDVETFERIKTLKVDRLYEGMNIRGVTGLTAAQRSALLALGAVEGVG
Download sequence
Identical sequences A0A1W5CIU6 Q3M9A6
240292.Ava_2817 gi|75909029|ref|YP_323325.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]