SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|75909078|ref|YP_323374.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75909078|ref|YP_323374.1|
Domain Number 1 Region: 525-729
Classification Level Classification E-value
Superfamily Precorrin-8X methylmutase CbiC/CobH 3.53e-73
Family Precorrin-8X methylmutase CbiC/CobH 0.000000403
Further Details:      
 
Domain Number 2 Region: 110-262
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 1.44e-25
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00037
Further Details:      
 
Domain Number 3 Region: 384-519
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 9.03e-25
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00062
Further Details:      
 
Domain Number 4 Region: 24-107
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 1.89e-20
Family Duplicated SiR/NiR-like domains 1 and 3 0.0083
Further Details:      
 
Domain Number 5 Region: 300-376
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 2.47e-20
Family Duplicated SiR/NiR-like domains 1 and 3 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|75909078|ref|YP_323374.1|
Sequence length 732
Comment precorrin-8X methylmutase [Anabaena variabilis ATCC 29413]
Sequence
MPIPRVSCLISASHREGVIVLLSGSTPCPGLFYATPAQDGILSRIRIPGGIINSKQCQAI
ADIADEYGGGYVDVTNRANIQIREIRADIDSPVLKRLQELGLGSRNTGVDQIRNIMTSPT
AGIDPQELIDTRSFVRSWDSYITENSALSRLSAKFSVCFDGGGLVSVSDRLNDITFAATL
VENRVYFRLCLSIGAKGKPPIDTGILLSPEECLPVLMALTEVYLAHTDAHNKRKPRLREV
VNSLGLDNYLQEVEKLLTISFGGKNLTPLPPSLVGKGEKTKHFSPLLVGEGLGERSHTKY
HHIGIHPQHQQNLYYIGLVLPLGRLETWQLKSLADLSAKYGNGTLRLTPWQNLLLTDIPQ
QWLTEVQSHILGLGLDFSAANIKSGLVACSGIQGCAAAATDTKSHALALADYLESHITLE
HPVTIHFSGCDKSCAHHGDSDITLLGVNNETGEGYQVYVGDRDSREKFGREVHPYIAVAE
LPTTIEQILGMYKNEYAKPDESFGQCTNHHETPQLKQLFPQANPMSDYIHDANEIYRNSF
AIIRSEANLDILPPDIAKVAVRLIHACGMTDIVTDLGYSATAAQSGRAALAVGAPILCDC
RMVADGVTRRRLPADNQVICTLNEPEVPELAKKLGNTRSAAALELWIPHLEGAVVAIGNA
PTALFRLLEMLDAGCPKPALILGFPVGFVGAAESKAALAADSRNIPYMTLHGRRGGSAIA
AAAVNALATEEE
Download sequence
Identical sequences Q3M957
240292.Ava_2866 gi|75909078|ref|YP_323374.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]