SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|75909152|ref|YP_323448.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75909152|ref|YP_323448.1|
Domain Number 1 Region: 494-980
Classification Level Classification E-value
Superfamily ALDH-like 7.2e-159
Family ALDH-like 0.00000000181
Further Details:      
 
Domain Number 2 Region: 129-455
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 1.1e-93
Family Proline dehydrohenase domain of bifunctional PutA protein 0.0000116
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|75909152|ref|YP_323448.1|
Sequence length 993
Comment L-proline dehydrogenase / delta-1-pyrroline-5-carboxylate dehydrogenase [Anabaena variabilis ATCC 29413]
Sequence
MVLQVQTSTYEAKTQEIARQLLGATQENRSFFASLRDQMRWDDKLLAWAMSNPGLRVQLF
RFIDTLPALHSKAEIAAHLQEYLGDESVELPAALKGMLNFANPDSVPGQVAATTVSTAVE
TLAHKYISGENIKQVIKTVERLRKEKMAFTIDLLGEAVITETEAQSYLERYLELISQLTE
ASKNWGTVGAIDEADGEQLAKVQVSVKLTAFYSQFDPLDAKGSEEKVSDRIRILLRRAKE
LGAAIHFDMEQYAYKNLTLNILQKILLEDEFRQRTDIGITIQAYLRDSEQDARNAIAWLK
QRGYPLTIRLVKGAYWDQETIKAAQKHWPQPVFNDKAATDANFEAITQLLLENNQYVYSA
IGSHNVRSQALAIAIAETLQVPRRRFEMQVLYGMGDKLAKALVDRGYRVRVYCPYGDLLP
GMAYLIRRLLENTANSSFLRQNLENRPVEELLAAPDINLAHAKAQRSKEEKGSFGATDTD
FAVEEERKEAARAFAEVRGALGRSYLPLINGEYVQTAEVIDSVNPSNFGEVIGKVGLISV
EQAEQAMQAAKAAFPGWRRTPVKERAAILRRAGDLLEERRAELSAWIVLEVGKPVKEADA
EVSEAIDFCRYYADEMERLYQGINYDVAGETNRYIYQPRGIVVVISPWNFPLAIACGMTV
AALVTGNCTLLKPAETSSVITAKLTEILLEAGIPKGVFQYVPGKGSQVGAYLVSHPDTHL
IAFTGSQEVGCRIYAEAATLKPQQRHMKRVIAEMGGKNAIIVDESADLDQAVIGVVQSAF
GYSGQKCSACSRVIVVEAIYDAFIHRLVEATKSLNIGEAELPSTQVGPVIDANARDRIRE
YIEKGKAESQVALELSAPNHGYFVGPVIFGEVPPHGTIAQQEIFGPVLAVIKAKDFAQAL
AIANDTDYALTGGLYSRTPSHIQQAQEEFEVGNLYINRNITGAIVARQPFGGFKLSGVGS
KAGGPDYLLQFLEPRTITENIQRQGFAPIEGAE
Download sequence
Identical sequences Q3M8Y3
gi|75909152|ref|YP_323448.1| 240292.Ava_2942

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]