SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|75909209|ref|YP_323505.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75909209|ref|YP_323505.1|
Domain Number 1 Region: 109-222
Classification Level Classification E-value
Superfamily Trimeric LpxA-like enzymes 2.36e-35
Family Galactoside acetyltransferase-like 0.013
Further Details:      
 
Domain Number 2 Region: 33-104
Classification Level Classification E-value
Superfamily Trimeric LpxA-like enzymes 0.00000000797
Family Galactoside acetyltransferase-like 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|75909209|ref|YP_323505.1|
Sequence length 231
Comment hexapaptide repeat-containing transferase [Anabaena variabilis ATCC 29413]
Sequence
MNHQRYSAKSQRFQELLAITVFGNIPTLLLGPKLRNLVYRMIFAHIGSPVYIQHGVEFTN
ASNIEIGNSVHLFKGVRLDAKGHPNNRIYLADGVAIERNVDIGCLENTCIHIDVETFIAS
DVCISGPGDITIGKRCMIAAHSGIYANNHNFTDPILPIKYQGVTCKGIVIEDDCWLGHGV
TVLDGVTIGKGSVIGAGAVVTKDIPPFSVAVGAPARVIKSRVAQDLVTSGD
Download sequence
Identical sequences A0A1W5CNH7 Q3M8S6
gi|75909209|ref|YP_323505.1| 240292.Ava_3000

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]