SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|75909228|ref|YP_323524.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75909228|ref|YP_323524.1|
Domain Number 1 Region: 9-137
Classification Level Classification E-value
Superfamily Ava3019-like 9.15e-46
Family Ava3019-like 0.000000162
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|75909228|ref|YP_323524.1|
Sequence length 138
Comment hypothetical protein Ava_3019 [Anabaena variabilis ATCC 29413]
Sequence
MSMPNHPNLTTADAKKILNKFNCLDIAPILKPSEKESVRRALILITKLSDYQILGICADT
ADEGLLAMKTYSHALGYEVPIDLPVVEGPVYIKLNGKNGLCYLDSYAGHHRGVLVSCQSY
YEGGINEMYGHLPLDLFV
Download sequence
Identical sequences A0A1W5CN76 Q3M8Q7
240292.Ava_3019 gi|75909228|ref|YP_323524.1| 367679

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]