SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|75909234|ref|YP_323530.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75909234|ref|YP_323530.1|
Domain Number 1 Region: 6-182
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 5.32e-45
Family N-acetyl transferase, NAT 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|75909234|ref|YP_323530.1|
Sequence length 192
Comment N-acetyltransferase GCN5 [Anabaena variabilis ATCC 29413]
Sequence
MKSELPIIASDRLILRIGIQEDIPKILKYFLENKDYLTPFYPTWVDQFFTAEYWHYQLEN
NFLEFIHDQSLKLFIFPKKRPTEIIGTINFNNFVKGAAHFCYVGYSLAETEQGKGYMTEA
LKAATDYVFEELNFHRVMAHYMPHNQRSGNVLKRLGFVVEGYARDYLLINGKWQDHILTS
LINPNWQENENG
Download sequence
Identical sequences A0A1W5CNB0 Q3M8Q1
gi|75909234|ref|YP_323530.1| 240292.Ava_3025

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]