SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|75909322|ref|YP_323618.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|75909322|ref|YP_323618.1|
Domain Number - Region: 214-284
Classification Level Classification E-value
Superfamily L-aspartase-like 0.0659
Family L-aspartase/fumarase 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|75909322|ref|YP_323618.1|
Sequence length 321
Comment ribonuclease BN [Anabaena variabilis ATCC 29413]
Sequence
MRSPVKSGTLFKETYLPSLKIMVQSRFVRFFRHLNWRTLKKTFTRTTERRLLGLGSEIAF
NAMLSLFPAILAVLTAIGFFADSLQDTFRQLAAQLSQVAPEEAMVLIREFAGREIANSRN
SGLFSLSFVIAIWTASGAVSTAMTAFDQIHQIPQEKIRPFWQSKLVSLGLTVGTILLLVL
ASFLVFISDLLLGMVVNKNGALIFLLHLWQLLRWPLALGIVATAFSFIYRYGTSVWKPGT
PIMPGAIIAAIFWAILSALFRLYVANFGNYNKVYGAVGTVIVLMLWLWMSAAVLLIGDQL
NVTVGEDMRSKASQDLAQEVG
Download sequence
Identical sequences Q3M8G3
gi|75909322|ref|YP_323618.1| 240292.Ava_3115

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]