SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|75909331|ref|YP_323627.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75909331|ref|YP_323627.1|
Domain Number 1 Region: 2-424
Classification Level Classification E-value
Superfamily Clc chloride channel 7.19e-91
Family Clc chloride channel 0.0000154
Further Details:      
 
Domain Number 2 Region: 430-566
Classification Level Classification E-value
Superfamily CBS-domain pair 1.27e-18
Family CBS-domain pair 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|75909331|ref|YP_323627.1|
Sequence length 596
Comment VWA containing CoxE-like protein [Anabaena variabilis ATCC 29413]
Sequence
MLFLAVLIGGGTGMGVVTFHYLIELIHHLMLENLMGAIGVWGAWTLALVPILGGLIVGLM
RWRTQDFGPGLSSLIAASEGSEIKGQLRPVTKMLAAAVSLGSGASLGPEGPSVEIGANFG
MLLSLILQVSQERQRLLLGAGAAAGLAAGFNAPIAGVFFALEVVMGATSFATSAVSVVLL
AAVVAALIAQIGLGAQPAFALPVYQVRSPLELPLYLGLGLGASLVSVAYKQSINWGKACF
VGSIPGFQFLGKIPQPIHPIIGGFMIGIVALKFPQILGIGYGTVQAMLQDVKFSLDLLLI
LLVLKLLMTAISAGSGFVGGLFAPAMFLGASLGSAYAKVLTLIAPGIGEYMAAPPAYAMV
GMAAVLAGSVRAPLTSILMLFELTRDYRIVLPLMAAVGLSVWLVERIKPNTNSHTNLQQI
GLSIPKDQKVEILQQILVEDAMLACPKKLPATLGILEAAREMISDRTRSALVIDDAEQLV
GIISLEDLNRTLSLWQNYPNSASEIQSNLTNQSIIDICTKEILYAWRDEPLSEALDRMEV
RGLHQLPVVARDNHDHILGLLDKEQIALTCNLAVTRQTLYRLVSSHQSLVSEKINN
Download sequence
Identical sequences Q3M8F4
240292.Ava_3124 gi|75909331|ref|YP_323627.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]